| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cytidine deaminase |
|---|
| Ligand | BDBM50335291 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_52531 |
|---|
| Ki | 10000±n/a nM |
|---|
| Citation |  Kim, CH; Marquez, VE; Mao, DT; Haines, DR; McCormack, JJ Synthesis of pyrimidin-2-one nucleosides as acid-stable inhibitors of cytidine deaminase. J Med Chem29:1374-80 (1986) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cytidine deaminase |
|---|
| Name: | Cytidine deaminase |
|---|
| Synonyms: | CDD_MOUSE | Cda | Cdd | Cytidine aminohydrolase |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 16129.75 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_52531 |
|---|
| Residue: | 146 |
|---|
| Sequence: | MAQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNIENACY
PLGVCAERTAIQKAISEGYKDFRAIAISSDLQEEFISPCGACRQVMREFGTDWAVYMTKP
DGTFVVRTVQELLPASFGPEDLQKIQ
|
|
|
|---|
| BDBM50335291 |
|---|
| n/a |
|---|
| Name | BDBM50335291 |
|---|
| Synonyms: | 9-(beta-D-ribofuranosyl)purine | CHEMBL1399702 | nebularine | purine ribonucleoside | purine riboside | purine-1-D-ribofuranoside |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H12N4O4 |
|---|
| Mol. Mass. | 252.2267 |
|---|
| SMILES | OC[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2cncnc12 |
|---|
| Structure | 
|
|---|
Search and Browse
