Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50013966 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_201137 |
---|
Ki | 31±n/a nM |
---|
Citation | de Costa, BR; Rice, KC; Bowen, WD; Thurkauf, A; Rothman, RB; Band, L; Jacobson, AE; Radesca, L; Contreras, PC; Gray, NM Synthesis and evaluation of N-substituted cis-N-methyl-2-(1-pyrrolidinyl)cyclohexylamines as high affinity sigma receptor ligands. Identification of a new class of highly potent and selective sigma receptor probes. J Med Chem33:3100-10 (1990) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50013966 |
---|
n/a |
---|
Name | BDBM50013966 |
Synonyms: | (2-Benzo[1,3]dioxol-5-yl-ethyl)-methyl-(2-pyrrolidin-1-yl-cyclohexyl)-amine | (2R)-N-[2-(2H-1,3-benzodioxol-5-yl)ethyl]-N-methyl-2-(pyrrolidin-1-yl)cyclohexan-1-amine |
Type | Small organic molecule |
Emp. Form. | C20H30N2O2 |
Mol. Mass. | 330.4644 |
SMILES | CN(CCc1ccc2OCOc2c1)C1CCCC[C@H]1N1CCCC1 |
Structure |
|