| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50010765 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201265 (CHEMBL873129) |
|---|
| IC50 | 20.0±n/a nM |
|---|
| Citation |  Scherz, MW; Fialeix, M; Fischer, JB; Reddy, NL; Server, AC; Sonders, MS; Tester, BC; Weber, E; Wong, ST; Keana, JF Synthesis and structure-activity relationships of N,N'-di-o-tolylguanidine analogues, high-affinity ligands for the haloperidol-sensitive sigma receptor. J Med Chem33:2421-9 (1990) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50010765 |
|---|
| n/a |
|---|
| Name | BDBM50010765 |
|---|
| Synonyms: | CHEMBL78488 | N-Adamantan-1-yl-N'-(2-nitro-phenyl)-guanidine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H22N4O2 |
|---|
| Mol. Mass. | 314.3822 |
|---|
| SMILES | N\C([N-]C12CC3CC(CC(C3)C1)C2)=[NH+]/c1ccccc1[N+]([O-])=O |TLB:10:5:12:9.11.8,10:9:12:5.4.6,6:7:11:5.4.10,THB:6:5:11:7.12.8| |
|---|
| Structure | 
|
|---|
Search and Browse
