| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50012477 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145688 (CHEMBL753314) |
|---|
| Ki | 9±n/a nM |
|---|
| Citation |  Galzi, JL; Mejean, A; Ilien, B; Mollereau, C; Meunier, JC; Goeldner, M; Hirth, C Photoactivatable opiate derivatives as irreversible probes of the mu-opioid receptor. J Med Chem33:2456-64 (1990) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50012477 |
|---|
| n/a |
|---|
| Name | BDBM50012477 |
|---|
| Synonyms: | 1-Phenethyl-4-(phenyl-propionyl-amino)-piperidine-4-carboxylic acid methyl ester | 1-Phenethyl-4-(phenyl-propionyl-amino)-piperidine-4-carboxylic acid methyl ester(Carefentanil) | CARFENTANIL | CHEMBL290429 | Carfentanil1-Phenethyl-4-(phenyl-propionyl-amino)-piperidine-4-carboxylic acid methyl ester | US20230399418, Compound Carfentanil |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H30N2O3 |
|---|
| Mol. Mass. | 394.5066 |
|---|
| SMILES | CCC(=O)N(c1ccccc1)C1(CCN(CCc2ccccc2)CC1)C(=O)OC |
|---|
| Structure | 
|
|---|
Search and Browse
