Reaction Details |
| Report a problem with these data |
Target | Glutathione S-transferase theta-1 |
---|
Ligand | BDBM50368152 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_138979 |
---|
Ki | 0.680000±n/a nM |
---|
Citation | Triggle, DJ; Kwon, YW; Abraham, P; Pitner, JB; Mascarella, SW; Carroll, FI Synthesis, molecular modeling studies, and muscarinic receptor activity of azaprophen analogues. J Med Chem34:3164-71 (1991) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Glutathione S-transferase theta-1 |
---|
Name: | Glutathione S-transferase theta-1 |
Synonyms: | GST 5-5 | GST class-theta-1 | GSTT1_RAT | Glutathione S-transferase 5 | Glutathione S-transferase theta 1 | Glutathione S-transferase theta-1 | Gstt1 |
Type: | PROTEIN |
Mol. Mass.: | 27472.53 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_138979 |
Residue: | 240 |
Sequence: | MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAFAQVNPMKKVPAMKDG
GFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTTLRRSCLRTLWHKVMF
PVFLGEQIRPEMLAATLADLDVNVQVLEDQFLQDKDFLVGPHISLADVVAITELMHPVGG
GCPVFEGRPRLAAWYRRVEAAVGKDLFLEAHEVILKVRDCPPADPVIKQKLMPRVLTMIQ
|
|
|
BDBM50368152 |
---|
n/a |
---|
Name | BDBM50368152 |
Synonyms: | CHEMBL318812 |
Type | Small organic molecule |
Emp. Form. | C22H25NO3 |
Mol. Mass. | 351.4388 |
SMILES | CN1CC2CC1CC(C2)OC(=O)C(O)(c1ccccc1)c1ccccc1 |THB:9:7:1.2:4,0:1:4:6.7.8| |
Structure |
|