Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50005703 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_160731 (CHEMBL767110) |
---|
IC50 | >100±n/a nM |
---|
Citation | Krohn, A; Redshaw, S; Ritchie, JC; Graves, BJ; Hatada, MH Novel binding mode of highly potent HIV-proteinase inhibitors incorporating the (R)-hydroxyethylamine isostere. J Med Chem34:3340-2 (1991) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50005703 |
---|
n/a |
---|
Name | BDBM50005703 |
Synonyms: | 2-[2-({1-[3-(2-Benzyloxycarbonylamino-3-carbamoyl-propionylamino)-2-hydroxy-4-phenyl-butyl]-pyrrolidine-2-carbonyl}-amino)-3-methyl-pentanoylamino]-3-methyl-butyric acid methyl ester | BDBM50010491 | CHEMBL111958 |
Type | Small organic molecule |
Emp. Form. | C39H56N6O9 |
Mol. Mass. | 752.8967 |
SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C[C@@H](O)[C@H](Cc1ccccc1)NC(=O)[C@H](CC(N)=O)NC(=O)OCc1ccccc1)C(=O)N[C@@H](C(C)C)C(=O)OC |
Structure |
|