| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50009127 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_145153 |
|---|
| Ki | 189±n/a nM |
|---|
| Citation |  Portoghese, PS; Garzon-Aburbeh, A; Nagase, H; Lin, CE; Takemori, AE Role of the spacer in conferring kappa opioid receptor selectivity to bivalent ligands related to norbinaltorphimine. J Med Chem34:1292-6 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50009127 |
|---|
| n/a |
|---|
| Name | BDBM50009127 |
|---|
| Synonyms: | bis(4-cyclopropylmethyl-12-oxa-4-azapentacyclo[9.6.1.01,13.05,17.07,18]octadeca-7(18),8,10,14-tetraene-10,17-diol)thiphene |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H42N2O6S |
|---|
| Mol. Mass. | 678.836 |
|---|
| SMILES | Oc1ccc2CC3N(CC4CC4)CC[C@@]45[C@@H](Oc1c24)c1sc2[C@@H]4Oc6c7c(CC8N(CC9CC9)CC[C@@]47[C@@]8(O)Cc2c1C[C@@]35O)ccc6O |TLB:3:4:43:7.13.12,45:26:37:29.35.34,17:18:43:7.13.12,24:25:37:29.35.34| |
|---|
| Structure | 
|
|---|
Search and Browse
