| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50229232 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_146263 (CHEMBL757487) |
|---|
| Ki | 0.005±n/a nM |
|---|
| Citation |  Portoghese, PS; Nagase, H; MaloneyHuss, KE; Lin, CE; Takemori, AE Role of spacer and address components in peptidomimetic delta opioid receptor antagonists related to naltrindole. J Med Chem34:1715-20 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50229232 |
|---|
| n/a |
|---|
| Name | BDBM50229232 |
|---|
| Synonyms: | CHEMBL610527 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H27NO3 |
|---|
| Mol. Mass. | 401.4975 |
|---|
| SMILES | [H][C@@]12Oc3c4c(C[C@@]5([H])N(CC6CC6)CC[C@@]14[C@@]5(O)CC=C2c1ccccc1)ccc3O |r,c:24,THB:10:9:17:4.5.6| |
|---|
| Structure | 
|
|---|
Search and Browse
