| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50006968 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201291 (CHEMBL805781) |
|---|
| IC50 | >10000±n/a nM |
|---|
| Citation |  Glennon, RA; Ismaiel, AM; Smith, JD; Yousif, M; el-Ashmawy, M; Herndon, JL; Fischer, JB; Howie, KJ; Server, AC Binding of substituted and conformationally restricted derivatives of N-(3-phenyl-n-propyl)-1-phenyl-2-aminopropane at sigma-receptors. J Med Chem34:1855-9 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50006968 |
|---|
| n/a |
|---|
| Name | BDBM50006968 |
|---|
| Synonyms: | (3-Phenyl-propyl)-(6,7,8,9-tetrahydro-5H-benzocyclohepten-7-yl)-amine | CHEMBL296601 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H25N |
|---|
| Mol. Mass. | 279.4192 |
|---|
| SMILES | C(CNC1CCc2ccccc2CC1)Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
