| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50000770 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_226553 (CHEMBL846630) |
|---|
| Ki | 39±n/a nM |
|---|
| Citation |  de Costa, B; Radesca, L; Dominguez, C; Di Paolo, L; Bowen, WD Synthesis and receptor binding properties of fluoro- and iodo-substituted high affinity sigma receptor ligands: identification of potential PET and SPECT sigma receptor imaging agents. J Med Chem35:2221-30 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50000770 |
|---|
| n/a |
|---|
| Name | BDBM50000770 |
|---|
| Synonyms: | 3-(5-Fluoro-pentyl)-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol | CHEMBL2368719 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H28FNO |
|---|
| Mol. Mass. | 305.4301 |
|---|
| SMILES | [H][C@]12Cc3ccc(O)cc3[C@@](C)(CCN1CCCCCF)[C@H]2C |r,THB:8:9:21:14.12.13,15:14:21:9.3.2| |
|---|
| Structure | 
|
|---|
Search and Browse
