| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50013388 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_146239 |
|---|
| IC50 | 1.8±n/a nM |
|---|
| Citation |  Dasher, WE; Klein, P; Nelson, WL Electrophilic opioid ligands. Oxygen tethered alpha-methylene-gamma-lactone, acrylate, isothiocyanate, and epoxide derivatives of 6 beta-naltrexol. J Med Chem35:2374-84 (1992) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50013388 |
|---|
| n/a |
|---|
| Name | BDBM50013388 |
|---|
| Synonyms: | 6-Ethyl-3-(1-hydroxy-cyclopropylmethyl)-11,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol | BREMAZOCINE(-) | Bremazocine | CHEMBL350384 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H29NO2 |
|---|
| Mol. Mass. | 315.4498 |
|---|
| SMILES | CCC12CCN(CC3(O)CC3)C(Cc3ccc(O)cc13)C2(C)C |TLB:6:5:20:19.13.12| |
|---|
| Structure | 
|
|---|
Search and Browse
