Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholinesterase
LigandBDBM50004656
Substrate/Competitorn/a
Meas. Tech.ChEBML_28926
Ki 66000±n/a nM
Citation Sowell JWTang YValli MJChapman JMUsher LAVaughan CMKosh JW Synthesis and cholinergic properties of bis[[(dimethylamino)methyl]furanyl] analogues of ranitidine. J Med Chem 35:1102-8 (1992) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Acetylcholinesterase
Name:Acetylcholinesterase
Synonyms:AChE | Acetylcholinesterase (AChE) | Acetylcholinesterase (mouse AChE) | Acetylcholinesterase precursor
Type:Enzyme
Mol. Mass.:68165.65
Organism:Mus musculus (mouse)
Description:n/a
Residue:614
Sequence:
MRPPWYPLHTPSLAFPLLFLLLSLLGGGARAEGREDPQLLVRVRGGQLRGIRLKAPGGPV
SAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSM
NYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASV
GMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTEL
IACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVG
VVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPE
DPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGY
EIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQ
YVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQERCSDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004656
n/a
NameBDBM50004656
Synonyms:(2-Carbamoyloxy-ethyl)-trimethyl-ammonium | (2-Carbamoyloxyethyl)trimethylammonium chloride | (2-Hydroxyethyl)trimethyl ammonium chloride carbamate | (2-Hydroxyethyl)trimethylammonium chloride carbamate | (carbachol)(2-Carbamoyloxy-ethyl)-trimethyl-ammonium | 2-((Aminocarbonyl)oxy)-N,N,N-trimethylethanaminium chloride | 2-((Aminocarbonyl)oxy)-N,N,N-trimethylethanaminum chloride | 2-(carbamoyloxy)-N,N,N-trimethylethanaminium | 2-(carbamoyloxy)-N,N,N-trimethylethanaminium chloride | CARBACHOL | CARBASTAT | CHEMBL14 | Carbachol chloride | Carbamylcholine | Choline carbamate chloride | Choline chloride, carbamate | Choline chlorine carbamate | Karbachol | Karbamoylcholin chlorid | MIOSTAT
TypeSmall organic molecule
Emp. Form.C6H15N2O2
Mol. Mass.147.195
SMILESC[N+](C)(C)CCOC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: