Reaction Details |
| Report a problem with these data |
Target | Neutrophil elastase |
---|
Ligand | BDBM50005894 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_63648 |
---|
IC50 | 39000±n/a nM |
---|
Citation | Zembower, DE; Kam, CM; Powers, JC; Zalkow, LH Novel anthraquinone inhibitors of human leukocyte elastase and cathepsin G. J Med Chem35:1597-605 (1992) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Neutrophil elastase |
---|
Name: | Neutrophil elastase |
Synonyms: | Bone marrow serine protease | Chymotrypsin | Coagulation factor X | ELA2 | ELANE | ELNE_HUMAN | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin |
Type: | Enzyme |
Mol. Mass.: | 28532.38 |
Organism: | Homo sapiens (Human) |
Description: | P08246 |
Residue: | 267 |
Sequence: | MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
|
|
|
BDBM50005894 |
---|
n/a |
---|
Name | BDBM50005894 |
Synonyms: | 2-Methylanthraquinone | 2-methyl-9,10-anthracenedione | 2-methyl-9,10-anthraquinone | 2-methylanthra-9,10-quinone | CHEMBL21745 | Tectoquinone | beta-methylanthraquinone |
Type | Small organic molecule |
Emp. Form. | C15H10O2 |
Mol. Mass. | 222.2387 |
SMILES | Cc1ccc2C(=O)c3ccccc3C(=O)c2c1 |
Structure |
|