Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D2 receptor/Serotonin 2 (5-HT2) receptor
LigandBDBM50054067
Substrate/Competitorn/a
Meas. Tech.ChEBML_62228
Ki 340±n/a nM
Citation Sonesson CBoije MSvensson KEkman ACarlsson ARomero AGMartin IJDuncan JNKing LJWikström H Orally active central dopamine and serotonin receptor ligands: 5-, 6-, 7-, and 8-[[trifluoromethyl)sulfonyl]oxy]-2-(di-n-propylamino)tetralins and the formation of active metabolites in vivo. J Med Chem 36:3409-16 (1993) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Dopamine D2 receptor/Serotonin 2 (5-HT2) receptor
Name:Dopamine D2 receptor and Serotonin 2a receptor (D2 and 5HT2a)
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DOPAMINE D2/D4 | DRD2 | Dopamine D2 receptor | Dopamine2-like
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:50931.60
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat striatal membranes.
Residue:444
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50054067
n/a
NameBDBM50054067
Synonyms:(2R)-7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol | (7-Hydroxy-1,2,3,4-tetrahydro-naphthalen-2-yl)-dipropyl-ammonium(R(+)7OH-DPAT) | (R)-7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-2-ol | (R)-7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol | (R)-7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol.HCl | 7-Dipropylamino-5,6,7,8-tetrahydro-naphthalen-2-ol | CHEMBL301559
TypeSmall organic molecule
Emp. Form.C16H25NO
Mol. Mass.247.3758
SMILESCCCN(CCC)[C@@H]1CCc2ccc(O)cc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: