| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM50006710 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_29296 |
|---|
| Ki | 1500±n/a nM |
|---|
| Citation |  Nonaka, Y; Shimada, J; Nonaka, H; Koike, N; Aoki, N; Kobayashi, H; Kase, H; Yamaguchi, K; Suzuki, F Photoisomerization of a potent and selective adenosine A2 antagonist, (E)-1,3-Dipropyl-8-(3,4-dimethoxystyryl)-7-methylxanthine. J Med Chem36:3731-3 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | A1 adenosine receptor | AA1R_CAVPO | ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | ADORA1 | Adenosine A1 receptor | Adenosine Receptor A1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 36501.39 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | ADENOSINE A1 ADORA1 GUINEA PIG::P47745 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPHSVSAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIASLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAAVAIAGCWILSLVVGLTPMFGWNNLSKIEMAWAANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLSKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCHKPTILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPEPPIDEDLPEEKVDD
|
|
|
|---|
| BDBM50006710 |
|---|
| n/a |
|---|
| Name | BDBM50006710 |
|---|
| Synonyms: | 8-[(E)-2-(3,4-Dimethoxy-phenyl)-vinyl]-7-methyl-1,3-dipropyl-3,7-dihydro-purine-2,6-dione | 8-[2-(3,4-Dimethoxy-phenyl)-vinyl]-7-methyl-1,3-dipropyl-3,7-dihydro-purine-2,6-dione | 8-[2-(3,4-Dimethoxy-phenyl)-vinyl]-7-methyl-1,3-dipropyl-3,7-dihydro-purine-2,6-dione; compound with 8-[2-(3,4-dimethoxy-phenyl)-vinyl]-7-methyl-1,3-dipropyl-3,7-dihydro-purine-2,6-dione | CHEMBL1795043 | CHEMBL27508 | KF-17837 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H28N4O4 |
|---|
| Mol. Mass. | 412.4821 |
|---|
| SMILES | CCCn1c2nc(\C=C\c3ccc(OC)c(OC)c3)n(C)c2c(=O)n(CCC)c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
