| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Platelet-activating factor receptor |
|---|
| Ligand | BDBM50046993 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_164922 (CHEMBL770633) |
|---|
| IC50 | 25800±n/a nM |
|---|
| Citation |  Lamouri, A; Heymans, F; Tavet, F; Dive, G; Batt, JP; Blavet, N; Braquet, P; Godfroid, JJ Design and modeling of new platelet-activating factor antagonists. 1. Synthesis and biological activity of 1,4-bis(3',4',5'-trimethoxybenzoyl)-2-[[(substituted carbonyl and carbamoyl)oxy]methyl]piperazines. J Med Chem36:990-1000 (1993) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Platelet-activating factor receptor |
|---|
| Name: | Platelet-activating factor receptor |
|---|
| Synonyms: | PAF-R | PTAFR | PTAFR_CAVPO | Platelet activating factor receptor | Platelet-activating factor receptor |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 39005.63 |
|---|
| Organism: | Cavia porcellus |
|---|
| Description: | n/a |
|---|
| Residue: | 342 |
|---|
| Sequence: | MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
|
|
|
|---|
| BDBM50046993 |
|---|
| n/a |
|---|
| Name | BDBM50046993 |
|---|
| Synonyms: | CHEMBL6322 | Diethyl-carbamic acid 1,4-bis-(3,4,5-trimethoxy-benzoyl)-piperazin-2-ylmethyl ester | Diethyl-carbamic acid 1,4-bis-(3,4,5-trimethoxy-benzoyl)-piperazin-2-ylmethyl ester(PMS 601) | PMS 601 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H41N3O10 |
|---|
| Mol. Mass. | 603.6606 |
|---|
| SMILES | CCN(CC)C(=O)OCC1CN(CCN1C(=O)c1cc(OC)c(OC)c(OC)c1)C(=O)c1cc(OC)c(OC)c(OC)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
