| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50041569 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_138750 (CHEMBL747923) |
|---|
| Ki | 66±n/a nM |
|---|
| Citation |  Portoghese, PS; Lin, CE; Farouz-Grant, F; Takemori, AE Structure-activity relationship of N17'-substituted norbinaltorphimine congeners. Role of the N17' basic group in the interaction with a putative address subsite on the kappa opioid receptor. J Med Chem37:1495-500 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50041569 |
|---|
| n/a |
|---|
| Name | BDBM50041569 |
|---|
| Synonyms: | 17-(cyclopropylmethyl)-17'-aminoethyl-6,6',7,7'-tetradehydro-4,5:4',5'-diepoxy-6,6'-imino-7,7'-bimorphinan-3,3',14,14'-tetrol | CHEMBL285052 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H43N5O8 |
|---|
| Mol. Mass. | 721.7981 |
|---|
| SMILES | NCC(=O)NCC(=O)N1CC[C@@]23[C@H]4Oc5c2c(C[C@@H]1[C@]3(O)Cc1c2C[C@@]3(O)[C@H]6Cc7ccc(O)c8O[C@@H](c2[nH]c41)[C@]3(CCN6CC1CC1)c78)ccc5O |
|---|
| Structure | 
|
|---|
Search and Browse
