Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50035111 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_202043 (CHEMBL809516) |
---|
IC50 | 7.7±n/a nM |
---|
Citation | Perregaard, J; Moltzen, EK; Meier, E; Sánchez, C Sigma ligands with subnanomolar affinity and preference for the sigma 2 binding site. 1. 3-(omega-aminoalkyl)-1H-indoles. J Med Chem38:1998-2008 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25266.54 |
Organism: | RAT |
Description: | Q9R0C9 |
Residue: | 223 |
Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
BDBM50035111 |
---|
n/a |
---|
Name | BDBM50035111 |
Synonyms: | 1'-{4-[1-(2-thienyl)-1H-3-indolyl]butyl}spiro[1,3-dihydroisobenzofuran-1,4'-(hexahydropyridine)] | CHEMBL61812 |
Type | Small organic molecule |
Emp. Form. | C28H30N2OS |
Mol. Mass. | 442.616 |
SMILES | C(CCc1cn(-c2cccs2)c2ccccc12)CN1CCC2(CC1)OCc1ccccc21 |
Structure |
|