Reaction Details |
| Report a problem with these data |
Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
---|
Ligand | BDBM50368906 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_204756 (CHEMBL882394) |
---|
IC50 | 0.90±n/a nM |
---|
Citation | Bakshi, RK; Rasmusson, GH; Patel, GF; Mosley, RT; Chang, B; Ellsworth, K; Harris, GS; Tolman, RL 4-Aza-3-oxo-5 alpha-androst-1-ene-17 beta-N-aryl-carboxamides as dual inhibitors of human type 1 and type 2 steroid 5 alpha-reductases. Dramatic effect of N-aryl substituents on type 1 and type 2 5 alpha-reductase inhibitory potency. J Med Chem38:3189-92 (1995) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
---|
Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | 5α-Reductase 1 (5α-R1) | S5A1_HUMAN | S5AR | SR type 1 | SRD5A1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
Type: | Enzyme |
Mol. Mass.: | 29472.80 |
Organism: | Homo sapiens (Human) |
Description: | P18405 |
Residue: | 259 |
Sequence: | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
|
|
|
BDBM50368906 |
---|
n/a |
---|
Name | BDBM50368906 |
Synonyms: | CHEMBL25448 | MK-386 |
Type | Small organic molecule |
Emp. Form. | C28H49NO |
Mol. Mass. | 415.6948 |
SMILES | CC(C)CCCC(C)[C@H]1CCC2C3[C@@H](C)CC4N(C)C(=O)CC[C@]4(C)C3CC[C@]12C |
Structure |
|