| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Ligand | BDBM50032778 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_204756 (CHEMBL882394) |
|---|
| IC50 | 20±n/a nM |
|---|
| Citation |  Bakshi, RK; Rasmusson, GH; Patel, GF; Mosley, RT; Chang, B; Ellsworth, K; Harris, GS; Tolman, RL 4-Aza-3-oxo-5 alpha-androst-1-ene-17 beta-N-aryl-carboxamides as dual inhibitors of human type 1 and type 2 steroid 5 alpha-reductases. Dramatic effect of N-aryl substituents on type 1 and type 2 5 alpha-reductase inhibitory potency. J Med Chem38:3189-92 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Name: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 |
|---|
| Synonyms: | 3-oxo-5-alpha-steroid 4-dehydrogenase 1 | 5α-Reductase 1 (5α-R1) | S5A1_HUMAN | S5AR | SR type 1 | SRD5A1 | Steroid 5-alpha-reductase | Steroid 5-alpha-reductase 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 29472.80 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P18405 |
|---|
| Residue: | 259 |
|---|
| Sequence: | MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
|
|
|
|---|
| BDBM50032778 |
|---|
| n/a |
|---|
| Name | BDBM50032778 |
|---|
| Synonyms: | (4aR,6aS)-4a,6a-Dimethyl-2-oxo-2,4a,4b,5,6,6a,7,8,9,9a,9b,10,11,11a-tetradecahydro-1H-indeno[5,4-f]quinoline-7-carboxylic acid phenylamide | CHEMBL324210 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H32N2O2 |
|---|
| Mol. Mass. | 392.5338 |
|---|
| SMILES | C[C@]12CCC3C(CCC4NC(=O)C=C[C@]34C)C1CCC2C(=O)Nc1ccccc1 |c:12| |
|---|
| Structure | 
|
|---|
Search and Browse
