| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50034043 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201901 (CHEMBL808192) |
|---|
| IC50 | 64±n/a nM |
|---|
| Citation |  Strupczewski, JT; Bordeau, KJ; Chiang, Y; Glamkowski, EJ; Conway, PG; Corbett, R; Hartman, HB; Szewczak, MR; Wilmot, CA; Helsley, GC 3-[[(Aryloxy)alkyl]piperidinyl]-1,2-benzisoxazoles as D2/5-HT2 antagonists with potential atypical antipsychotic activity: antipsychotic profile of iloperidone (HP 873). J Med Chem38:1119-31 (1995) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50034043 |
|---|
| n/a |
|---|
| Name | BDBM50034043 |
|---|
| Synonyms: | 1-(4-{3-[4-(6-Fluoro-benzo[d]isoxazol-3-yl)-piperidin-1-yl]-propoxy}-3-methoxy-phenyl)-ethanone | CHEMBL14376 | ILOPERIDONE |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H27FN2O4 |
|---|
| Mol. Mass. | 426.4806 |
|---|
| SMILES | COc1cc(ccc1OCCCN1CCC(CC1)c1noc2cc(F)ccc12)C(C)=O |
|---|
| Structure | 
|
|---|
Search and Browse
