| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50048873 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201746 (CHEMBL809880) |
|---|
| Ki | 66±n/a nM |
|---|
| Citation |  Berardi, F; Colabufo, NA; Giudice, G; Perrone, R; Tortorella, V; Govoni, S; Lucchi, L New sigma and 5-HT1A receptor ligands: omega-(tetralin-1-yl)-n-alkylamine derivatives. J Med Chem39:176-82 (1996) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50048873 |
|---|
| n/a |
|---|
| Name | BDBM50048873 |
|---|
| Synonyms: | 1-Benzyl-4-[3-(3,4-dihydro-naphthalen-1-yl)-propyl]-piperazine | CHEMBL50029 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H30N2 |
|---|
| Mol. Mass. | 346.5084 |
|---|
| SMILES | C(CN1CCN(Cc2ccccc2)CC1)CC1=CCCc2ccccc12 |t:18| |
|---|
| Structure | 
|
|---|
Search and Browse
