Reaction Details |
| Report a problem with these data |
Target | Muscarinic receptor M1 |
---|
Ligand | BDBM50452855 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_140161 (CHEMBL745466) |
---|
Ki | 0.410000±n/a nM |
---|
Citation | Visser, TJ; van Waarde, A; Jansen, TJ; Visser, GM; van der Mark, TW; Kraan, J; Ensing, K; Vaalburg, W Stereoselective synthesis and biodistribution of potent [11C]-labeled antagonists for positron emission tomography imaging of muscarinic receptors in the airways. J Med Chem40:117-24 (1997) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Muscarinic receptor M1 |
---|
Name: | Muscarinic receptor M1 |
Synonyms: | Muscarinic acetylcholine receptor M1 |
Type: | PROTEIN |
Mol. Mass.: | 15022.43 |
Organism: | Bos taurus |
Description: | ChEMBL_140161 |
Residue: | 139 |
Sequence: | ETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRTPRLLQAYS
WKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPAKQPPRSSPNTVKRPTRKG
RERAGKGQKPRGKEQLAKR
|
|
|
BDBM50452855 |
---|
n/a |
---|
Name | BDBM50452855 |
Synonyms: | Isoptpo Hyoscine | Scopolamine |
Type | Small organic molecule |
Emp. Form. | C17H21NO4 |
Mol. Mass. | 303.3529 |
SMILES | [H][C@@]12O[C@@]1([H])[C@]1([H])C[C@@H](C[C@@]2([H])N1C)OC(=O)[C@H](CO)c1ccccc1 |r,TLB:14:8:12:1.3,2:1:12:8.7.9,2:3:12:8.7.9| |
Structure |
|