| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Muscarinic receptor M1 |
|---|
| Ligand | BDBM50055978 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_140161 (CHEMBL745466) |
|---|
| Ki | 0.02±n/a nM |
|---|
| Citation |  Visser, TJ; van Waarde, A; Jansen, TJ; Visser, GM; van der Mark, TW; Kraan, J; Ensing, K; Vaalburg, W Stereoselective synthesis and biodistribution of potent [11C]-labeled antagonists for positron emission tomography imaging of muscarinic receptors in the airways. J Med Chem40:117-24 (1997) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Muscarinic receptor M1 |
|---|
| Name: | Muscarinic receptor M1 |
|---|
| Synonyms: | Muscarinic acetylcholine receptor M1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 15022.43 |
|---|
| Organism: | Bos taurus |
|---|
| Description: | ChEMBL_140161 |
|---|
| Residue: | 139 |
|---|
| Sequence: | ETENRARELAALQGSETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRTPRLLQAYS
WKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPAKQPPRSSPNTVKRPTRKG
RERAGKGQKPRGKEQLAKR
|
|
|
|---|
| BDBM50055978 |
|---|
| n/a |
|---|
| Name | BDBM50055978 |
|---|
| Synonyms: | 4-((R)-2-Cyclohexyl-2-hydroxy-2-phenyl-acetoxy)-1,1-dimethyl-piperidinium; iodide | CHEMBL21905 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H32NO3 |
|---|
| Mol. Mass. | 346.4831 |
|---|
| SMILES | C[N+]1(C)CCC(CC1)OC(=O)[C@@](O)(C1CCCCC1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
