Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVitamin K-dependent protein C
LigandBDBM50060046
Substrate/Competitorn/a
Meas. Tech.ChEMBL_27847
Ki 33000±n/a nM
Citation Stürzebecher JPrasa DHauptmann JVieweg HWikström P Synthesis and structure-activity relationships of potent thrombin inhibitors: piperazides of 3-amidinophenylalanine. J Med Chem 40:3091-9 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vitamin K-dependent protein C
Name:Vitamin K-dependent protein C
Synonyms:Activated protein C cofactor | Anticoagulant protein C | Apolipoprotein H | Autoprothrombin IIA | Blood coagulation factor XIV | Coagulation factor V | Coagulation factor V heavy chain | Coagulation factor V light chain | Endothelial protein C receptor | Proaccelerin, labile factor | Vitamin K-dependent protein C precursor
Type:Enzyme
Mol. Mass.:52067.73
Organism:Homo sapiens (Human)
Description:n/a
Residue:461
Sequence:
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK
FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060046
n/a
NameBDBM50060046
Synonyms:3-[(R)-2-[2-(7,7-Dimethyl-2-oxo-bicyclo[2.2.1]hept-1-yl)-ethanesulfonylamino]-3-(4-methanesulfonyl-piperazin-1-yl)-3-oxo-propyl]-benzamidine | CHEMBL319035
TypeSmall organic molecule
Emp. Form.C26H39N5O6S2
Mol. Mass.581.748
SMILESCC1(C)C2CCC1(CCS(=O)(=O)N[C@H](Cc1cccc(c1)C(N)=N)C(=O)N1CCN(CC1)S(C)(=O)=O)C(=O)C2 |TLB:37:36:1:5.4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: