| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1A |
|---|
| Ligand | BDBM50061646 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1413 (CHEMBL616201) |
|---|
| Ki | 0.30±n/a nM |
|---|
| Citation |  Mewshaw, RE; Kavanagh, J; Stack, G; Marquis, KL; Shi, X; Kagan, MZ; Webb, MB; Katz, AH; Park, A; Kang, YH; Abou-Gharbia, M; Scerni, R; Wasik, T; Cortes-Burgos, L; Spangler, T; Brennan, JA; Piesla, M; Mazandarani, H; Cockett, MI; Ochalski, R; Coupet, J; Andree, TH New generation dopaminergic agents. 1. Discovery of a novel scaffold which embraces the D2 agonist pharmacophore. Structure-activity relationships of a series of 2-(aminomethyl)chromans. J Med Chem40:4235-56 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1A |
|---|
| Name: | 5-hydroxytryptamine receptor 1A |
|---|
| Synonyms: | 5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A (5HT1A) | 5HT1A_RAT | 5ht1a | G-21 | Htr1a | Serotonin 1 (5-HT1) receptor | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 46445.29 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Binding assays were performed using rat hippocampal membranes. |
|---|
| Residue: | 422 |
|---|
| Sequence: | MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
|
|
|
|---|
| BDBM50061646 |
|---|
| n/a |
|---|
| Name | BDBM50061646 |
|---|
| Synonyms: | 2-{[3-(3-Methyl-benzo[d]isoxazol-6-yloxy)-propylamino]-methyl}-chroman-7-ol; oxalic acid | CHEMBL134930 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24N2O4 |
|---|
| Mol. Mass. | 368.4263 |
|---|
| SMILES | Cc1noc2cc(OCCCNCC3CCc4ccc(O)cc4O3)ccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
