Reaction Details |
| Report a problem with these data |
Target | 5-hydroxytryptamine receptor 1A |
---|
Ligand | BDBM50061649 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1413 (CHEMBL616201) |
---|
Ki | 0.19±n/a nM |
---|
Citation | Mewshaw, RE; Kavanagh, J; Stack, G; Marquis, KL; Shi, X; Kagan, MZ; Webb, MB; Katz, AH; Park, A; Kang, YH; Abou-Gharbia, M; Scerni, R; Wasik, T; Cortes-Burgos, L; Spangler, T; Brennan, JA; Piesla, M; Mazandarani, H; Cockett, MI; Ochalski, R; Coupet, J; Andree, TH New generation dopaminergic agents. 1. Discovery of a novel scaffold which embraces the D2 agonist pharmacophore. Structure-activity relationships of a series of 2-(aminomethyl)chromans. J Med Chem40:4235-56 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
5-hydroxytryptamine receptor 1A |
---|
Name: | 5-hydroxytryptamine receptor 1A |
Synonyms: | 5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A (5HT1A) | 5HT1A_RAT | 5ht1a | G-21 | Htr1a | Serotonin 1 (5-HT1) receptor | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 46445.29 |
Organism: | Rattus norvegicus (rat) |
Description: | Binding assays were performed using rat hippocampal membranes. |
Residue: | 422 |
Sequence: | MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
|
|
|
BDBM50061649 |
---|
n/a |
---|
Name | BDBM50061649 |
Synonyms: | 2-{[3-(Benzooxazol-5-yloxy)-propylamino]-methyl}-chroman-7-ol; oxalic acid | CHEMBL134677 |
Type | Small organic molecule |
Emp. Form. | C20H22N2O4 |
Mol. Mass. | 354.3997 |
SMILES | Oc1ccc2CCC(CNCCCOc3ccc4ocnc4c3)Oc2c1 |
Structure |
|