Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR4
LigandBDBM50056404
Substrate/Competitorn/a
Meas. Tech.ChEMBL_3340
Ki 257±n/a nM
Citation Yang DSoulier JLSicsic SMathé-Allainmat MBrémont BCroci TCardamone RAureggi GLanglois M New esters of 4-amino-5-chloro-2-methoxybenzoic acid as potent agonists and antagonists for 5-HT4 receptors. J Med Chem 40:608-21 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
HTR4
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-4 | 5-HT4 | 5-HT4L | 5-HT4S | 5-hydroxytryptamine receptor 4 | Serotonin (5-HT) receptor | Serotonin 4 (5-HT4) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:46117.31
Organism:RAT
Description:5-HT4 HTR4 RAT::Q62758
Residue:406
Sequence:
MDRLDANVSSNEGFGSVEKVVLLTFFAMVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVNAFGAIELVQDIWFYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDVIEKRKFNHNSN
STFCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRP
QTADQHSTHRMRTETKAAKTLCVIMGCFCFCWAPFFVTNIVDPFIDYTVPEKVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYKRPPILGQTVPCSTTTINGSTHVLRD
TVECGGQWESRCHLTATSPLVAAQPVIRRPQDNDLEDSCSLKRSQS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056404
n/a
NameBDBM50056404
Synonyms:3-Isopropyl-2-oxo-2,3-dihydro-benzoimidazole-1-carboxylic acid (8-methyl-8-aza-bicyclo[3.2.1]oct-3-yl)-amide | BIMU 8 | CHEMBL59834
TypeSmall organic molecule
Emp. Form.C19H26N4O2
Mol. Mass.342.4353
SMILESCC(C)n1c2ccccc2n(C(=O)NC2CC3CCC(C2)N3C)c1=O |TLB:13:14:21:17.18|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: