Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 1
LigandBDBM50056464
Substrate/Competitorn/a
Meas. Tech.ChEMBL_46811
Ki 26±n/a nM
Citation Sheskin THanus LSlager JVogel ZMechoulam R Structural requirements for binding of anandamide-type compounds to the brain cannabinoid receptor. J Med Chem 40:659-67 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 1
Name:Cannabinoid receptor 1
Synonyms:Brain-type cannabinoid receptor | CANNABINOID CB1 | CB-R | CB1 | Cannabinoid CB1 receptor | Cannabinoid receptor 1 (CB1)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:52856.55
Organism:Rattus norvegicus (rat)
Description:P20272
Residue:473
Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAI
AVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHV
FHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCL
MWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILW
KAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPL
LAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA
QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056464
n/a
NameBDBM50056464
Synonyms:(5Z,8Z,11Z,14Z)-2,2-Dimethyl-icosa-5,8,11,14-tetraenoic acid (2-hydroxy-ethyl)-amide | CHEMBL423382
TypeSmall organic molecule
Emp. Form.C24H41NO2
Mol. Mass.375.5878
SMILESCCCCC\C=C/C\C=C/C\C=C/C\C=C/CCC(C)(C)C(=O)NCCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: