| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50064190 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_200979 (CHEMBL801232) |
|---|
| Ki | 15±n/a nM |
|---|
| Citation |  Ronsisvalle, G; Marrazzo, A; Prezzavento, O; Pasquinucci, L; Vittorio, F; Pittalà, V; Pappalardo, MS; Cacciaguerra, S; Spampinato, S (+)-cis-N-ethyleneamino-N-normetazocine derivatives. Novel and selective sigma ligands with antagonist properties. J Med Chem41:1574-80 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50064190 |
|---|
| n/a |
|---|
| Name | BDBM50064190 |
|---|
| Synonyms: | (2S,6R,11S)-3-(2-Diethylamino-ethyl)-6,11-dimethyl-1,2,3,4,5,6-hexahydro-2,6-methano-benzo[d]azocin-8-ol | CHEMBL39284 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H32N2O |
|---|
| Mol. Mass. | 316.4809 |
|---|
| SMILES | CCN(CC)CCN1CC[C@]2(C)[C@H](C)[C@@H]1Cc1ccc(O)cc21 |TLB:6:7:12:22.16.15| |
|---|
| Structure | 
|
|---|
Search and Browse
