| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50040253 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201743 (CHEMBL809877) |
|---|
| Ki | >50±n/a nM |
|---|
| Citation |  Chern, JW; Tao, PL; Wang, KC; Gutcait, A; Liu, SW; Yen, MH; Chien, SL; Rong, JK Studies on quinazolines and 1,2,4-benzothiadiazine 1,1-dioxides. 8.1, 2 synthesis and pharmacological evaluation of tricyclic fused quinazolines and 1,2,4-benzothiadiazine 1,1-dioxides as potential alpha1-adrenoceptor antagonists. J Med Chem41:3128-41 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25124.85 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99720 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50040253 |
|---|
| n/a |
|---|
| Name | BDBM50040253 |
|---|
| Synonyms: | 3-{2-[4-(2-Methoxy-phenyl)-piperazin-1-yl]-ethyl}-1H-quinazoline-2,4-dione | CHEMBL51433 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H24N4O3 |
|---|
| Mol. Mass. | 380.4403 |
|---|
| SMILES | COc1ccccc1N1CCN(CCn2c(=O)[nH]c3ccccc3c2=O)CC1 |
|---|
| Structure | 
|
|---|
Search and Browse
