Reaction Details |
| Report a problem with these data |
Target | Sigma non-opioid intracellular receptor 1 |
---|
Ligand | BDBM50040260 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_201743 (CHEMBL809877) |
---|
Ki | 4000±n/a nM |
---|
Citation | Chern, JW; Tao, PL; Wang, KC; Gutcait, A; Liu, SW; Yen, MH; Chien, SL; Rong, JK Studies on quinazolines and 1,2,4-benzothiadiazine 1,1-dioxides. 8.1, 2 synthesis and pharmacological evaluation of tricyclic fused quinazolines and 1,2,4-benzothiadiazine 1,1-dioxides as potential alpha1-adrenoceptor antagonists. J Med Chem41:3128-41 (1998) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Sigma non-opioid intracellular receptor 1 |
---|
Name: | Sigma non-opioid intracellular receptor 1 |
Synonyms: | Aging-associated gene 8 protein | OPRS1 | SGMR1_HUMAN | SIG-1R | SIGMAR1 | SR-BP | SR31747-binding protein | SRBP | Sigma 1-type opioid receptor | Sigma opioid receptor | Sigma1R | hSigmaR1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25124.85 |
Organism: | Homo sapiens (Human) |
Description: | Q99720 |
Residue: | 223 |
Sequence: | MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
|
|
|
BDBM50040260 |
---|
n/a |
---|
Name | BDBM50040260 |
Synonyms: | 2-[4-(2-Methoxy-phenyl)-piperazin-1-ylmethyl]-2,6-dihydro-3H-imidazo[1,2-c]quinazolin-5-one | CHEMBL302021 |
Type | Small organic molecule |
Emp. Form. | C22H25N5O2 |
Mol. Mass. | 391.4662 |
SMILES | COc1ccccc1N1CCN(CC2CN3C(=N2)c2ccccc2NC3=O)CC1 |c:17| |
Structure |
|