| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A3 |
|---|
| Ligand | BDBM50179023 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_30469 (CHEMBL643130) |
|---|
| Ki | 38±n/a nM |
|---|
| Citation |  Baraldi, PG; Cacciari, B; Pineda de Las Infantas, MJ; Romagnoli, R; Spalluto, G; Volpini, R; Costanzi, S; Vittori, S; Cristalli, G; Melman, N; Park, KS; Ji, XD; Jacobson, KA Synthesis and biological activity of a new series of N6-arylcarbamoyl, 2-(Ar)alkynyl-N6-arylcarbamoyl, and N6-carboxamido derivatives of adenosine-5'-N-ethyluronamide as A1 and A3 adenosine receptor agonists. J Med Chem41:3174-85 (1998) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A3 |
|---|
| Name: | Adenosine receptor A3 |
|---|
| Synonyms: | AA3R_RAT | Adenosine A3 receptor | Adenosine receptor A2a and A3 | Adora3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 36643.73 |
|---|
| Organism: | Rattus norvegicus |
|---|
| Description: | ChEMBL_479910 |
|---|
| Residue: | 320 |
|---|
| Sequence: | MKANNTTTSALWLQITYITMEAAIGLCAVVGNMLVIWVVKLNRTLRTTTFYFIVSLALAD
IAVGVLVIPLAIAVSLEVQMHFYACLFMSCVLLVFTHASIMSLLAIAVDRYLRVKLTVRY
RTVTTQRRIWLFLGLCWLVSFLVGLTPMFGWNRKVTLELSQNSSTLSCHFRSVVGLDYMV
FFSFITWILIPLVVMCIIYLDIFYIIRNKLSQNLTGFRETRAFYGREFKTAKSLFLVLFL
FALCWLPLSIINFVSYFNVKIPEIAMCLGILLSHANSMMNPIVYACKIKKFKETYFVILR
ACRLCQTSDSLDSNLEQTTE
|
|
|
|---|
| BDBM50179023 |
|---|
| n/a |
|---|
| Name | BDBM50179023 |
|---|
| Synonyms: | 1-benzyl-3-(9-((2R,3R,4S,5S)-5-(ethylcarbamoyl)-3,4-dihydroxy-tetrahydrofuran-2-yl)-9H-purin-6-yl)urea | CHEMBL426847 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H23N7O5 |
|---|
| Mol. Mass. | 441.4405 |
|---|
| SMILES | CCNC(=O)[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(NC(=O)NCc3ccccc3)ncnc12 |
|---|
| Structure | 
|
|---|
Search and Browse
