| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Corticotropin-releasing factor receptor 1 |
|---|
| Ligand | BDBM50074430 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_51131 (CHEMBL664192) |
|---|
| Ki | 67±n/a nM |
|---|
| Citation |  Hodge, CN; Aldrich, PE; Wasserman, ZR; Fernandez, CH; Nemeth, GA; Arvanitis, A; Cheeseman, RS; Chorvat, RJ; Ciganek, E; Christos, TE; Gilligan, PJ; Krenitsky, P; Scholfield, E; Strucely, P Corticotropin-releasing hormone receptor antagonists: framework design and synthesis guided by ligand conformational studies. J Med Chem42:819-32 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Corticotropin-releasing factor receptor 1 |
|---|
| Name: | Corticotropin-releasing factor receptor 1 |
|---|
| Synonyms: | CRF-R | CRF1 | CRFR1_RAT | CRH-R 1 | Corticotropin releasing factor receptor | Corticotropin releasing factor receptor 1 | Corticotropin-releasing Factor Receptor 1 | Corticotropin-releasing hormone receptor 1 | Crhr | Crhr1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 47870.75 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Receptor binding assays were performed using rat cortex homogenate. |
|---|
| Residue: | 415 |
|---|
| Sequence: | MGRRPQLRLVKALLLLGLNPVSTSLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
|
|
|
|---|
| BDBM50074430 |
|---|
| n/a |
|---|
| Name | BDBM50074430 |
|---|
| Synonyms: | 1-(2-Bromo-4-isopropyl-phenyl)-4-chloro-6-methyl-1H-pyrrolo[2,3-b]pyridine | CHEMBL353774 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H16BrClN2 |
|---|
| Mol. Mass. | 363.679 |
|---|
| SMILES | CC(C)c1ccc(c(Br)c1)-n1ccc2c(Cl)cc(C)nc12 |
|---|
| Structure | 
|
|---|
Search and Browse
