Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2Y purinoceptor 1
LigandBDBM50076466
Substrate/Competitorn/a
Meas. Tech.ChEMBL_147722
IC50 158±n/a nM
Citation Nandanan ECamaioni EJang SYKim YCCristalli GHerdewijn PSecrist JATiwari KNMohanram AHarden TKBoyer JLJacobson KA Structure-activity relationships of bisphosphate nucleotide derivatives as P2Y1 receptor antagonists and partial agonists. J Med Chem 42:1625-38 (1999) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
P2Y purinoceptor 1
Name:P2Y purinoceptor 1
Synonyms:n/a
Type:n/a
Mol. Mass.:41199.64
Organism:Meleagris gallopavo
Description:n/a
Residue:362
Sequence:
MTEALISAALNGTQPELLAGGWAAGNASTKCSLTKTGFQFYYLPTVYILVFITGFLGNSV
AIWMFVFHMRPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDVMCKLQRFIF
HVNLYGSILFLTCISVHRYTGVVHPLKSLGRLKKKNAVYVSSLVWALVVAVIAPILFYSG
TGVRRNKTITCYDTTADEYLRSYFVYSMCTTVFMFCIPFIVILGCYGLIVKALIYKDLDN
SPLRRKSIYLVIIVLTVFAVSYLPFHVMKTLNLRARLDFQTPQMCAFNDKVYATYQVTRG
LASLNSCVDPILYFLAGDTFRRRLSRATRKSSRRSEPNVQSKSEEMTLNILTEYKQNGDT
SL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50076466
n/a
NameBDBM50076466
Synonyms:2-(6-Methylamino-purin-9-yl)-5,7,9,11-tetraoxo-tetrahydro-1,4,6,8,10,12-hexaoxa-5lambda*5*,7lambda*5*,9lambda*5*,11lambda*5*-tetraphospha-cyclopentacyclododecene-5,7,9,11-tetraol | CHEMBL296960
TypeSmall organic molecule
Emp. Form.C11H17N5O14P4
Mol. Mass.567.1728
SMILESCNc1ncnc2n(cnc12)C1CC2OP(O)(=O)OP(O)(=O)OP(O)(=O)OP(O)(=O)OCC2O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: