| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50091016 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_147188 (CHEMBL759361) |
|---|
| Ki | 3500±n/a nM |
|---|
| Citation |  Ronsisvalle, G; Pasquinucci, L; Pittalà, V; Marrazzo, A; Prezzavento, O; Di Toro, R; Falcucci, B; Spampinato, S Nonpeptide analogues of dynorphin A(1-8): design, synthesis, and pharmacological evaluation of kappa-selective agonists. J Med Chem43:2992-3004 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | OPRD_RAT | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Oprd1 | Ror-a | Voltage-gated potassium channel |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40465.04 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50091016 |
|---|
| n/a |
|---|
| Name | BDBM50091016 |
|---|
| Synonyms: | 2-(8-Hydroxy-6,11-dimethyl-1,2,5,6-tetrahydro-4H-2,6-methano-benzo[d]azocin-3-ylmethyl)-1-phenyl-cyclopropanecarboxylic acid {[1-(4-guanidino-butylcarbamoyl)-3-methyl-butylcarbamoyl]-methyl}-amide | CHEMBL420091 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H55N7O4 |
|---|
| Mol. Mass. | 673.8878 |
|---|
| SMILES | CC(C)CC(NC(=O)CNC(=O)[C@@]1(CC1CN1CC[C@]2(C)C(C)C1Cc1ccc(O)cc21)c1ccccc1)C(=O)NCCCCNC(N)=N |TLB:22:21:31.25.24:16.18.17| |
|---|
| Structure | 
|
|---|
Search and Browse
