| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50369588 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_145274 (CHEMBL751210) |
|---|
| Ki | 240±n/a nM |
|---|
| Citation |  Wentland, MP; Duan, W; Cohen, DJ; Bidlack, JM Selective protection and functionalization of morphine: synthesis and opioid receptor binding properties of 3-amino-3-desoxymorphine derivatives. J Med Chem43:3558-65 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50369588 |
|---|
| n/a |
|---|
| Name | BDBM50369588 |
|---|
| Synonyms: | CHEMBL119332 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H24N2O2 |
|---|
| Mol. Mass. | 312.4061 |
|---|
| SMILES | CN(C)c1ccc2C[C@@H]3[C@@H]4C=C[C@H](O)[C@@H]5Oc1c2[C@]45CCN3C |c:10| |
|---|
| Structure | 
|
|---|
Search and Browse
