Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetP2Y purinoceptor 1
LigandBDBM50085824
Substrate/Competitorn/a
Meas. Tech.ChEMBL_222620
IC50 805±n/a nM
Citation Nandanan EJang SYMoro SKim HOSiddiqui MARuss PMarquez VEBusson RHerdewijn PHarden TKBoyer JLJacobson KA Synthesis, biological activity, and molecular modeling of ribose-modified deoxyadenosine bisphosphate analogues as P2Y(1) receptor ligands. J Med Chem 43:829-42 (2000) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
P2Y purinoceptor 1
Name:P2Y purinoceptor 1
Synonyms:n/a
Type:n/a
Mol. Mass.:41199.64
Organism:Meleagris gallopavo
Description:n/a
Residue:362
Sequence:
MTEALISAALNGTQPELLAGGWAAGNASTKCSLTKTGFQFYYLPTVYILVFITGFLGNSV
AIWMFVFHMRPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDVMCKLQRFIF
HVNLYGSILFLTCISVHRYTGVVHPLKSLGRLKKKNAVYVSSLVWALVVAVIAPILFYSG
TGVRRNKTITCYDTTADEYLRSYFVYSMCTTVFMFCIPFIVILGCYGLIVKALIYKDLDN
SPLRRKSIYLVIIVLTVFAVSYLPFHVMKTLNLRARLDFQTPQMCAFNDKVYATYQVTRG
LASLNSCVDPILYFLAGDTFRRRLSRATRKSSRRSEPNVQSKSEEMTLNILTEYKQNGDT
SL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50085824
n/a
NameBDBM50085824
Synonyms:CHEMBL352744 | Phosphoric acid mono-[3-(2-chloro-6-methylamino-purin-9-yl)-2-phosphonooxymethyl-cyclobutyl] ester
TypeSmall organic molecule
Emp. Form.C11H16ClN5O8P2
Mol. Mass.443.674
SMILESCNc1nc(Cl)nc2n(cnc12)[C@@H]1C[C@H](OP(O)(O)=O)C1COP(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: