Reaction Details |
| Report a problem with these data |
Target | Dihydrofolate reductase |
---|
Ligand | BDBM50100253 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_55111 (CHEMBL665438) |
---|
IC50 | 26000±n/a nM |
---|
Citation | Gangjee, A; Vidwans, A; Elzein, E; McGuire, JJ; Queener, SF; Kisliuk, RL Synthesis, antifolate, and antitumor activities of classical and nonclassical 2-amino-4-oxo-5-substituted-pyrrolo[2,3-d]pyrimidines. J Med Chem44:1993-2003 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Dihydrofolate reductase |
---|
Name: | Dihydrofolate reductase |
Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
Type: | Enzyme |
Mol. Mass.: | 21638.84 |
Organism: | Rattus norvegicus (rat) |
Description: | n/a |
Residue: | 187 |
Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
BDBM50100253 |
---|
n/a |
---|
Name | BDBM50100253 |
Synonyms: | 2-Amino-5-[(3-chloro-phenylamino)-methyl]-3,7-dihydro-pyrrolo[2,3-d]pyrimidin-4-one | CHEMBL61110 |
Type | Small organic molecule |
Emp. Form. | C13H12ClN5O |
Mol. Mass. | 289.72 |
SMILES | Nc1nc2[nH]cc(CNc3cccc(Cl)c3)c2c(=O)[nH]1 |
Structure |
|