| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50101472 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_159290 (CHEMBL766055) |
|---|
| IC50 | 0.72±n/a nM |
|---|
| Citation |  Hagen, SE; Domagala, J; Gajda, C; Lovdahl, M; Tait, BD; Wise, E; Holler, T; Hupe, D; Nouhan, C; Urumov, A; Zeikus, G; Zeikus, E; Lunney, EA; Pavlovsky, A; Gracheck, SJ; Saunders, J; VanderRoest, S; Brodfuehrer, J 4-Hydroxy-5,6-dihydropyrones as inhibitors of HIV protease: the effect of heterocyclic substituents at C-6 on antiviral potency and pharmacokinetic parameters. J Med Chem44:2319-32 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50101472 |
|---|
| n/a |
|---|
| Name | BDBM50101472 |
|---|
| Synonyms: | 3-(2-tert-Butyl-4-hydroxymethyl-5-methyl-phenylsulfanyl)-4-hydroxy-6-[2-(1H-indol-3-yl)-ethyl]-6-isopropyl-5,6-dihydro-pyran-2-one | CHEMBL308615 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H37NO4S |
|---|
| Mol. Mass. | 507.684 |
|---|
| SMILES | CC(C)C1(CCc2c[nH]c3ccccc23)CC(=O)C(Sc2cc(C)c(CO)cc2C(C)(C)C)C(=O)O1 |
|---|
| Structure | 
|
|---|
Search and Browse
