Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50098812
Substrate/Competitorn/a
Meas. Tech.ChEMBL_63965
Ki 43.8±n/a nM
Citation Ohmoto KYamamoto TOkuma MHoriuchi TImanishi HOdagaki YKawabata KSekioka THirota YMatsuoka SNakai HToda MCheronis JCSpruce LWGyorkos AWieczorek M Development of orally active nonpeptidic inhibitors of human neutrophil elastase. J Med Chem 44:1268-85 (2001) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50098812
n/a
NameBDBM50098812
Synonyms:2-[2-(4-Fluoro-phenyl)-6-oxo-6H-pyrimidin-1-yl]-N-{2-methyl-1-[5-(1-methyl-cyclopropyl)-[1,3,4]oxadiazole-2-carbonyl]-propyl}-acetamide | CHEMBL23080
TypeSmall organic molecule
Emp. Form.C23H24FN5O4
Mol. Mass.453.4662
SMILESCC(C)[C@H](NC(=O)Cn1c(nccc1=O)-c1ccc(F)cc1)C(=O)c1nnc(o1)C1(C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: