Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetArachidonate 15-lipoxygenase
LigandBDBM50065996
Substrate/Competitorn/a
Meas. Tech.ChEMBL_20
IC50 250±n/a nM
Citation Whitman SGezginci MTimmermann BNHolman TR Structure-activity relationship studies of nordihydroguaiaretic acid inhibitors toward soybean, 12-human, and 15-human lipoxygenase. J Med Chem 45:2659-61 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Arachidonate 15-lipoxygenase
Name:Arachidonate 15-lipoxygenase
Synonyms:15-Lipoxygenase-1 (15-LOX-1) | Arachidonate 15-lipoxygenase-1 | Reticulocyte 15-lipoxygenase-1
Type:Protein
Mol. Mass.:74804.05
Organism:Homo sapiens (Human)
Description:n/a
Residue:662
Sequence:
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPL
LFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP
QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAK
GLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV
LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL
VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH
LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVS
LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQH
ASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ
PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSV
AI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50065996
n/a
NameBDBM50065996
Synonyms:4-[(2S,3R)-4-(4-Hydroxy-3-methoxy-phenyl)-2,3-dimethyl-butyl]-benzene-1,2-diol | 4-[4-(4-Hydroxy-3-methoxy-phenyl)-2,3-dimethyl-butyl]-benzene-1,2-diol | CHEMBL316139
TypeSmall organic molecule
Emp. Form.C19H24O4
Mol. Mass.316.3915
SMILESCOc1cc(C[C@@H](C)[C@@H](C)Cc2ccc(O)c(O)c2)ccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: