Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase IV
LigandBDBM11427
Substrate/Competitorn/a
Meas. Tech.ChEMBL_45269
Ki 3±n/a nM
Citation Masereel BRolin SAbbate FScozzafava ASupuran CT Carbonic anhydrase inhibitors: anticonvulsant sulfonamides incorporating valproyl and other lipophilic moieties. J Med Chem 45:312-20 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase IV
Name:Carbonic anhydrase
Synonyms:CA-IV | Carbonate dehydratase IV | Carbonic anhydrase 4
Type:Enzyme
Mol. Mass.:35152.74
Organism:Bos taurus (bovine)
Description:Bovine isozyme, isolated from lung microsomes
Residue:312
Sequence:
MRLLLALLVLAAAPPQARAASHWCYQIQVKPSNYTCLEPDEWEGSCQNNRQSPVNIVTAK
TQLDPNLGRFSFSGYNMKHQWVVQNNGHTVMVLLENKPSIAGGGLSTRYQATQLHLHWSR
AMDRGSEHSFDGERFAMEMHIVHEKEKGLSGNASQNQFAEDEIAVLAFMVEDGSKNVNFQ
PLVEALSDIPRPNMNTTMKEGVSLFDLLPEEESLRHYFRYLGSLTTPTCDEKVVWTVFQK
PIQLHRDQILAFSQKLFYDDQQKVNMTDNVRPVQSLGQRQVFRSGAPGLLLAQPLPTLLA
PVLACLTVGFLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11427
n/a
NameBDBM11427
Synonyms:2-N-(4-methylbenzene)-1,3,4-thiadiazole-2,5-disulfonamido | 5-{[(4-methylphenyl)sulfonyl]amino}-1,3,4-thiadiazole-2-sulfonamide | CHEMBL108380 | Methylbenzolamide
TypeSmall organic molecule
Emp. Form.C9H10N4O4S3
Mol. Mass.334.395
SMILESCc1ccc(cc1)S(=O)(=O)Nc1nnc(s1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: