Reaction Details |
| Report a problem with these data |
Target | Corticotropin-releasing factor receptor 1 |
---|
Ligand | BDBM50119607 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_51127 (CHEMBL663562) |
---|
IC50 | 12±n/a nM |
---|
Citation | Rivier, J; Gulyas, J; Kirby, D; Low, W; Perrin, MH; Kunitake, K; DiGruccio, M; Vaughan, J; Reubi, JC; Waser, B; Koerber, SC; Martinez, V; Wang, L; Taché, Y; Vale, W Potent and long-acting corticotropin releasing factor (CRF) receptor 2 selective peptide competitive antagonists. J Med Chem45:4737-47 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Corticotropin-releasing factor receptor 1 |
---|
Name: | Corticotropin-releasing factor receptor 1 |
Synonyms: | CRF-R | CRF1 | CRFR1_RAT | CRH-R 1 | Corticotropin releasing factor receptor | Corticotropin releasing factor receptor 1 | Corticotropin-releasing Factor Receptor 1 | Corticotropin-releasing hormone receptor 1 | Crhr | Crhr1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 47870.75 |
Organism: | Rattus norvegicus (rat) |
Description: | Receptor binding assays were performed using rat cortex homogenate. |
Residue: | 415 |
Sequence: | MGRRPQLRLVKALLLLGLNPVSTSLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
|
|
|
BDBM50119607 |
---|
n/a |
---|
Name | BDBM50119607 |
Synonyms: | CHEMBL440057 | E G P P I S I D L S L E L L R K M I E I E K Q E K E K Q Q A A N N R L L L D T I I-NH2(r/h CRF) | Human corticotropin releasing factor |
Type | Small organic molecule |
Emp. Form. | C208H343N59O64S2 |
Mol. Mass. | 4758.436 |
SMILES | n/a |
Structure |
|