| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sigma non-opioid intracellular receptor 1 |
|---|
| Ligand | BDBM50120473 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_201584 (CHEMBL809861) |
|---|
| Ki | 22700±n/a nM |
|---|
| Citation |  Maier, CA; Wünsch, B Novel sigma receptor ligands. Part 2. SAR of spiro[[2]benzopyran-1,4'-piperidines] and spiro[[2]benzofuran-1,4'-piperidines] with carbon substituents in position 3. J Med Chem45:4923-30 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sigma non-opioid intracellular receptor 1 |
|---|
| Name: | Sigma non-opioid intracellular receptor 1 |
|---|
| Synonyms: | Opioid receptor | Oprs1 | SGMR1_RAT | Sigma | Sigma non-opioid intracellular receptor 1 | Sigma opioid receptor | Sigma-1 | Sigmar1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25266.54 |
|---|
| Organism: | RAT |
|---|
| Description: | Q9R0C9 |
|---|
| Residue: | 223 |
|---|
| Sequence: | MPWAVGRRWAWITLFLTIVAVLIQAVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWREGTTKSEVYYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALSDTIFSTQDFLTLFYTLRAYARGLRLELTTYLFGQDP
|
|
|
|---|
| BDBM50120473 |
|---|
| n/a |
|---|
| Name | BDBM50120473 |
|---|
| Synonyms: | CHEMBL148236 | ethyl 2-[1'-benzylspiro[3,4-dihydro-1H-isochromene-1,4'-(hexahydropyridine)]-3-yl]acetate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H29NO3 |
|---|
| Mol. Mass. | 379.492 |
|---|
| SMILES | CCOC(=O)CC1Cc2ccccc2C2(CCN(Cc3ccccc3)CC2)O1 |
|---|
| Structure | 
|
|---|
Search and Browse
