Reaction Details |
| Report a problem with these data |
Target | Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM50121496 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_158026 (CHEMBL768619) |
---|
Ki | 2.1±n/a nM |
---|
Kd | 102±n/a nM |
---|
KON | 304000 M-1s-1 |
---|
Citation | Markgren, PO; Schaal, W; Hämäläinen, M; Karlén, A; Hallberg, A; Samuelsson, B; Danielson, UH Relationships between structure and interaction kinetics for HIV-1 protease inhibitors. J Med Chem45:5430-9 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Gag-Pol polyprotein [489-587] |
---|
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM50121496 |
---|
n/a |
---|
Name | BDBM50121496 |
Synonyms: | 2-({2,5-Bis-benzyloxy-5-[(1-carboxy-2-methyl-propyl)-methyl-carbamoyl]-3-hydroxy-pentanoyl}-methyl-amino)-3-methyl-butyric acid | CHEMBL150907 |
Type | Small organic molecule |
Emp. Form. | C32H44N2O9 |
Mol. Mass. | 600.6998 |
SMILES | CC(C)C(N(C)C(=O)[C@@H](C[C@@H](O)[C@@H](OCc1ccccc1)C(=O)N(C)C(C(C)C)C(O)=O)OCc1ccccc1)C(O)=O |
Structure |
|