| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50179191 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_70854 (CHEMBL680354) |
|---|
| IC50 | 40.7±n/a nM |
|---|
| Citation |  Balboni, G; Salvadori, S; Guerrini, R; Negri, L; Giannini, E; Jinsmaa, Y; Bryant, SD; Lazarus, LH Potent delta-opioid receptor agonists containing the Dmt-Tic pharmacophore. J Med Chem45:5556-63 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50179191 |
|---|
| n/a |
|---|
| Name | BDBM50179191 |
|---|
| Synonyms: | (S)-N-((1H-benzo[d]imidazol-2-yl)methyl)-2-((S)-2-amino-3-(4-hydroxy-2,6-dimethylphenyl)propanoyl)-1,2,3,4-tetrahydroisoquinoline-3-carboxamide | 2-[2-Amino-3-(4-hydroxy-2,6-dimethyl-phenyl)-propionyl]-1,2,3,4-tetrahydro-isoquinoline-3-carboxylic acid (1H-benzoimidazol-2-ylmethyl)-amide | CHEMBL109390 | H-Dmt-Tic-NH-CH2-Bid | UFP-502 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H31N5O3 |
|---|
| Mol. Mass. | 497.5881 |
|---|
| SMILES | Cc1cc(O)cc(C)c1C[C@H](N)C(=O)N1Cc2ccccc2C[C@H]1C(=O)NCc1nc2ccccc2[nH]1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
