Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow affinity neurotrophin receptor p75NTR
LigandBDBM50111443
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144432
IC50 3720±n/a nM
Citation Toogood PL Inhibition of protein-protein association by small molecules: approaches and progress. J Med Chem 45:1543-58 (2002) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Low affinity neurotrophin receptor p75NTR
Name:Low affinity neurotrophin receptor p75NTR
Synonyms:CD_antigen=CD271 | Gp80-LNGFR | Low-affinity nerve growth factor receptor | NGF receptor | Tumor necrosis factor receptor superfamily member 16 | p75 ICD
Type:PROTEIN
Mol. Mass.:45159.83
Organism:Homo sapiens (Human)
Description:ChEMBL_346884
Residue:427
Sequence:
MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGAN
QTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTG
RCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLREC
TRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQ
PVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK
LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWR
HLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50111443
n/a
NameBDBM50111443
Synonyms:2-(2-Hydroxy-ethylamino)-5-nitro-benzo[de]isoquinoline-1,3-dione(ALE-0540) | CHEMBL440470
TypeSmall organic molecule
Emp. Form.C14H11N3O5
Mol. Mass.301.2542
SMILESOCCNN1C(=O)c2cccc3cc(cc(C1=O)c23)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: