| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dihydrofolate reductase |
|---|
| Ligand | BDBM50101634 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_55110 (CHEMBL665437) |
|---|
| IC50 | 390±n/a nM |
|---|
| Citation |  Graffner-Nordberg, M; Fyfe, M; Brattsand, R; Mellgård, B; Hallberg, A Design and synthesis of dihydrofolate reductase inhibitors encompassing a bridging ester group. Evaluation in a mouse colitis model. J Med Chem46:3455-62 (2003) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Dihydrofolate reductase |
|---|
| Name: | Dihydrofolate reductase |
|---|
| Synonyms: | DYR_RAT | Dhfr | Dihydrofolate reductase (DHFR) | Dihydrofolate reductase; P. carinii vs rat | Tetrahydrofolate dehydrogenase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 21638.84 |
|---|
| Organism: | Rattus norvegicus (rat) |
|---|
| Description: | n/a |
|---|
| Residue: | 187 |
|---|
| Sequence: | MVRPLNCIVAVSQNMGIGKNGDLPWPLLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRELKEPPQGAHFLAKSLDDALKLIEQPELASKVDMVWVVGGSS
VYQEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSEIQEEKGIKYKF
EVYEKKD
|
|
|
|---|
| BDBM50101634 |
|---|
| n/a |
|---|
| Name | BDBM50101634 |
|---|
| Synonyms: | Benzoic acid 2,4-diamino-quinazolin-6-ylmethyl ester | CHEMBL421319 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H14N4O2 |
|---|
| Mol. Mass. | 294.308 |
|---|
| SMILES | Nc1nc(N)c2cc(COC(=O)c3ccccc3)ccc2n1 |
|---|
| Structure | 
|
|---|
Search and Browse
