Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHydroxycarboxylic acid receptor 2
LigandBDBM50132133
Substrate/Competitorn/a
Meas. Tech.ChEMBL_144336
Ki 37900±n/a nM
Citation van Herk TBrussee Jvan den Nieuwendijk AMvan der Klein PAIJzerman APStannek CBurmeister ALorenzen A Pyrazole derivatives as partial agonists for the nicotinic acid receptor. J Med Chem 46:3945-51 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hydroxycarboxylic acid receptor 2
Name:Hydroxycarboxylic acid receptor 2
Synonyms:HM74 nicotinic acid GPCR
Type:PROTEIN
Mol. Mass.:41476.06
Organism:Rattus norvegicus
Description:ChEMBL_820675
Residue:360
Sequence:
MSKQNHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSR
IFLFNLAVADFLLIICLPFLTDNYVQNWDWRFGSIPCRVMLFMLAMNRQGSIIFLTVVAV
DRYFRVVHPHHFLNKISNRTAAIISCFLWGITIGLTVHLLYTDMMTRNGDANLCSSFSIC
YTFRWHDAMFLLEFFLPLGIILFCSGRIIWSLRQRQMDRHVKIKRAINFIMVVAIVFVIC
FLPSVAVRIRIFWLLYKHNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPN
FFSTCINRCLRRKTLGEPDNNRSTSVELTGDPSTIRSIPGALMTDPSEPGSPPYLASTSR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50132133
n/a
NameBDBM50132133
Synonyms:5-p-Tolyl-1H-pyrazole-3-carboxylic acid | CHEMBL341154 | cid_818267
TypeSmall organic molecule
Emp. Form.C11H10N2O2
Mol. Mass.202.2093
SMILESCc1ccc(cc1)-c1cc([nH]n1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: